PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010540473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family WOX
Protein Properties Length: 392aa    MW: 43049.2 Da    PI: 8.719
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010540473.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.5e-1848108257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  XP_010540473.1  48 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 108
                     89*****************99*************************************995 PP

2Wus_type_Homeobox112.81.8e-3647109264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
     XP_010540473.1  47 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 109
                        579**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-736107IPR009057Homeodomain-like
SuperFamilySSF466892.95E-1244112IPR009057Homeodomain-like
PROSITE profilePS5007110.44644109IPR001356Homeobox domain
SMARTSM003899.9E-946113IPR001356Homeobox domain
CDDcd000861.87E-847109No hitNo description
PfamPF000462.0E-1548108IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGSSNRHWPS MFKSKPHHQW QHDINSPILP SRSSPFSSGC EERSPDPKPR WNPKPEQIRI  60
LEAIFNSGMV NPPRDEIRRI RAQLQEYGQV GDANVFYWFQ NRKSRSKHKL RLLHNSKRSP  120
SQPQTQTLNS SASPSSSSSS SSPKSTKLYN TKNYTNSDTF NSNNTDIALG VNSSSIIPKG  180
GPVAVEKNPV LGMFPAEPAF LFPVSPMTTA GAFEGFTGGS HLGFVSGQMM SNVVTQEQKP  240
GAATTVGPCT GLLLSEIMNS VSYNGTNLSV KEHEEMRMKM LQQPQNLCYA TSSNTAPTSS  300
YNNSVVPSLS SASVTVSSVS DHRDQLQVQA GEKIRVYVNE MEVEVIYGPF NVREAFGSEE  360
AVLIDSAGQP VLTDEYGVLL RPLQHGASYY LI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010540473.10.0PREDICTED: WUSCHEL-related homeobox 9-like isoform X1
SwissprotQ6X7J41e-145WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLV4M6W21e-148V4M6W2_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0004_18721e-143(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-74homeobox-3